PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13158s0105.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 819aa    MW: 89501.9 Da    PI: 6.5083
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13158s0105.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.8e-20123178156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t++q++ Le++F+++ +p++++r +L+++l+L+ rqVk+WFqNrR+++k
  Bostr.13158s0105.1.p 123 KKRYHRHTPKQIQDLESVFKECAHPDEKQRLDLSRRLNLDPRQVKFWFQNRRTQMK 178
                           688999***********************************************999 PP

2START182.42.5e-573305492206
                           HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                 START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                           la++a++elvk+a+ +ep+Wv+ss    e +n++e+ ++f +  +     + +ea+++ g v+ ++  lve+l+d+  +W e+++    
  Bostr.13158s0105.1.p 330 LALAAMDELVKMAQTREPLWVRSSdtgfEVLNQEEYDTSFNRCVGpkpdgFVSEASKEAGTVIINSLALVETLMDSE-RWAEMFPnmis 417
                           6899********************999966666666666644333777999**************************.*********** PP

                           EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                 START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                           + +t+e is+g      gal+lm aelq+lsplvp R + f+R+++q+ +g+w++vd S+ds ++++ sss+ R   lpSg+l+++++n
  Bostr.13158s0105.1.p 418 RTSTTEIISNGmggtrnGALHLMHAELQLLSPLVPvRQVSFLRFCKQHAEGVWAVVDLSIDSITERS-SSSCRR---LPSGCLVQDMAN 502
                           ******************************************************************9.777766...************ PP

                           CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           g+skvtw+eh++++++ +h l+r+l++ gla+ga +w+a+lqrqce+
  Bostr.13158s0105.1.p 503 GYSKVTWIEHTEYDENRIHRLYRPLLNCGLAFGAHRWMAALQRQCEC 549
                           *********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-2097181IPR009057Homeodomain-like
SuperFamilySSF466892.97E-19111180IPR009057Homeodomain-like
PROSITE profilePS5007117.086120180IPR001356Homeobox domain
SMARTSM003891.9E-18121184IPR001356Homeobox domain
PfamPF000461.8E-17123178IPR001356Homeobox domain
CDDcd000861.83E-17123180No hitNo description
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
PROSITE profilePS5084840.678320552IPR002913START domain
SuperFamilySSF559611.22E-31323549No hitNo description
CDDcd088751.21E-110324548No hitNo description
SMARTSM002341.8E-43329549IPR002913START domain
PfamPF018521.6E-49330549IPR002913START domain
SuperFamilySSF559612.47E-17578810No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MNFNGFLDDN SSGVDGAGAS KLLSDVPYNN HFSFSAVDTM LGTTAITPSH HSLTPHSRPF  60
SSPGLSLELQ TNGEMSRNGE ILESNVTRKS SRGEDVESRS ESDNAEAVSG DDLDTSDRPL  120
KKKKRYHRHT PKQIQDLESV FKECAHPDEK QRLDLSRRLN LDPRQVKFWF QNRRTQMKTQ  180
IERHENALLR QENDKLRAEN MSVREAMRNP ICGNCGGPAV IGEISMEEQH LRIENSRLKD  240
ELDRVCALTG KFLGRSNGSH HIPDSALVLG VGVGSGGCNG GGFTLSSPSL PQASPRFEIS  300
NGTGSCLATV NRQPPVSVSD FDQRSRYLDL ALAAMDELVK MAQTREPLWV RSSDTGFEVL  360
NQEEYDTSFN RCVGPKPDGF VSEASKEAGT VIINSLALVE TLMDSERWAE MFPNMISRTS  420
TTEIISNGMG GTRNGALHLM HAELQLLSPL VPVRQVSFLR FCKQHAEGVW AVVDLSIDSI  480
TERSSSSCRR LPSGCLVQDM ANGYSKVTWI EHTEYDENRI HRLYRPLLNC GLAFGAHRWM  540
AALQRQCECL TILMSSTLSP SPSPTPINCN GRKSMLKLAK RMTDNFCGGV CASSLQKWSK  600
LNVGNVDEDI RIMTRKSVNN PGEPPGIVLN AATSVWMPVS PRRLFDFLGN ERLRSEWDIL  660
SNGGPTKEMA HIAKGHDHSN SVSLRASTIN ANQSSMLILQ ETSIDAAGAV VVYAPVDIPA  720
MQAVMNGGDS AYVALLPSGF AIHPDGQAGT QRSAAEERDV NGNGGCMEEG GSLLTVAFQI  780
LVNSLPTAKL TVESVETVNN LISCTVQKIK AALHCDST*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00418DAPTransfer from AT3G61150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0508660.0AY050866.1 Arabidopsis thaliana putative homeobox protein (At3g61150) mRNA, complete cds.
GenBankAY0967570.0AY096757.1 Arabidopsis thaliana putative homeobox protein (At3g61150) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191674.10.0homeodomain GLABROUS 1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLD7LS630.0D7LS63_ARALL; Putative uncharacterized protein
STRINGAT3G61150.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112827105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1